PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P16410_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 402aa    MW: 44902.6 Da    PI: 5.1328
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P16410_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.41.3e-93313983374
                    GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             el+ ecA+a++++d +++++lL+ l+ela+p+gd  q+la+yf++AL  r ++ ++ +y +l + ++++++ +++ +++  f+evsP
  GSMUA_Achr10P16410_001  31 ELIQECAKAIAEKDSSKIHHLLWMLNELATPYGDCDQKLASYFLQALLCRATEAGELCYTTLISAAEKQQSFVTARKVMLKFQEVSP 117
                             67889*******************************************************998888887777777778778****** PP

                    GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                             + +f+h++ N aI+ea+ege+++Hi+D++ ++++QWp+L++aLasR +++p+lR+T+v+   s     + e+g+r+ kfA+ +gvpf
  GSMUA_Achr10P16410_001 118 WTTFGHVASNGAIMEAMEGESKLHIVDISNTYCTQWPTLMEALASRGSDTPHLRLTVVAM-VSMGGSVMDEIGRRMVKFARLMGVPF 203
                             ***********************************************************9.667999******************** PP

                    GRAS 177 efnvl.vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..nsesFlerflea 260
                             ef+v+ +a++l +l+ eeL ++++Ea++Vn+v +l r+      +e+ rd++++++  l+P+vv+vve+ead   +++++++ f ++
  GSMUA_Achr10P16410_001 204 EFRVVsIASTLGQLTEEELGLRKDEAVVVNCVGALRRVR-----VEE-RDAFVRMLCALRPRVVTVVEEEADFttSKGDLVACFEQC 284
                             *****8888****************************97.....454.99********************998546679******** PP

                    GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                             +++ys ++ +le++++++s+er  +E+e  +r+i  v+ac+g    er+e++++W erl+ea F p ++++++  + ++ll+++  +
  GSMUA_Achr10P16410_001 285 VKFYSIFLGMLEESFSPTSNERFLLEKE-CSRSILGVLACNGGGVSERREKASQWCERLTEA-FAPTAFNDDVIGDLEALLERYR-E 368
                             ****************************.89*****************************98.**********************.8 PP

                    GRAS 348 gyrve...eesgslvlgWkdrpLvsvSaWr 374
                             g+++     + + l+l+Wk +p+v++SaW+
  GSMUA_Achr10P16410_001 369 GWSLVpakGNAAGLYLTWKAEPVVWASAWK 398
                             877774324466788**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.283376IPR005202Transcription factor GRAS
PfamPF035144.6E-9131398IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MQNTDPCHHH PSISCLLEPK DPREEEKWAA ELIQECAKAI AEKDSSKIHH LLWMLNELAT  60
PYGDCDQKLA SYFLQALLCR ATEAGELCYT TLISAAEKQQ SFVTARKVML KFQEVSPWTT  120
FGHVASNGAI MEAMEGESKL HIVDISNTYC TQWPTLMEAL ASRGSDTPHL RLTVVAMVSM  180
GGSVMDEIGR RMVKFARLMG VPFEFRVVSI ASTLGQLTEE ELGLRKDEAV VVNCVGALRR  240
VRVEERDAFV RMLCALRPRV VTVVEEEADF TTSKGDLVAC FEQCVKFYSI FLGMLEESFS  300
PTSNERFLLE KECSRSILGV LACNGGGVSE RREKASQWCE RLTEAFAPTA FNDDVIGDLE  360
ALLERYREGW SLVPAKGNAA GLYLTWKAEP VVWASAWKPI KP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-265939833375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381696.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF71e-131SHR_ARATH; Protein SHORT-ROOT
TrEMBLM0RIR60.0M0RIR6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P16410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35263781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-126GRAS family protein